PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010906634.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family HB-PHD
Protein Properties Length: 777aa    MW: 86990.3 Da    PI: 5.1697
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010906634.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox45.21.6e-14635686556
                     SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++f +  ++ L + F++n+yps+e++e+LA +lg+t rq+  WF N R  ++
  XP_010906634.1 635 RRFDPVVTQKLHDSFKENQYPSRETKERLAIELGMTSRQIGKWFENARHSMR 686
                     57899999****************************************8876 PP

2PHD40.94.6e-14235290151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ C++     +++++lCdg C++ fH+kCl+++l se++p+g   wlC+ C++k
  XP_010906634.1 235 FCAKCSSkdLSVDNDIILCDGaCDRGFHQKCLDPPLLSENIPSGdeGWLCPACDCK 290
                     6999*9955445********66*********************9*9*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579035.09E-14225293IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.0E-12229290IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.119233290IPR019787Zinc finger, PHD-finger
SMARTSM002494.9E-10235288IPR001965Zinc finger, PHD-type
PfamPF006281.8E-11235290IPR019787Zinc finger, PHD-finger
CDDcd155045.00E-29235287No hitNo description
PROSITE patternPS013590236287IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007113.847628688IPR001356Homeobox domain
SMARTSM003896.4E-13631692IPR001356Homeobox domain
SuperFamilySSF466897.27E-13634693IPR009057Homeodomain-like
CDDcd000866.69E-13634686No hitNo description
Gene3DG3DSA:1.10.10.604.2E-14636693IPR009057Homeodomain-like
PfamPF000467.1E-12636686IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    Send to blast
MLWALLVTAT YLDFFLHQEQ GLKSEGIEND STEVGRADSN HVDSDKLTTL AEHDKSIKPN  60
SQKADMKHGA KKNSKRTLQK GKKASQSLRG KRYFLRSSLD GVRVLRSMSK GKSKTPAESV  120
TPPVNPTTKR RKRRGKVKGA SKDEFSLTRK RVRYLLTRIN YEQSLIDAYS SEGWKGQSLE  180
KLRPEKELER AKSEILRCKL KIRDSFRCLD SLLSAGRLQE SLFDSDGQIC SEDIFCAKCS  240
SKDLSVDNDI ILCDGACDRG FHQKCLDPPL LSENIPSGDE GWLCPACDCK VDCIDLLSEF  300
QGSSDLSIED SWEKVFPEAA AIANSDKQYD LSNLPSDDSE DDNYDPDVLE VDTEDHMEES  360
SSEEDHEEQS SSEESYFTYS SEDSGPSEKR KHYEDIGLSS DDSEDDDYDP EGPDPDKEIQ  420
KESSGSDESD FTSDSDDFCA ELSKSGGTDE VSASSLPNLK PLEPSGEGER VSDRNENATN  480
SEQPSMLEPD PSQKNALPVS GKRQRDRLDY KKLYDETYGK ASSDSSDDED WSDKNALKKG  540
KKDDHVEETD VLKARSKSTE NYRSSGRAKR KATVENIVTK SDLVQKQVLL ATSEDTPKKA  600
YQQKLQSASL HHTQKHDDPW EPDSNGDGAT TSVQRRFDPV VTQKLHDSFK ENQYPSRETK  660
ERLAIELGMT SRQIGKWFEN ARHSMRVSAK EANHAVVSTP EEGTSSTKAK GNNDKPDKGG  720
VRNYASNGSK GKKSVGERND EVGAGRDTSS GEKRKDTQEN NRKKAIEREL RKRRKSR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1752774KRKDTQENNRKKAIERELRKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010906634.10.0PREDICTED: homeobox protein HOX1A isoform X3
RefseqXP_010906635.10.0PREDICTED: homeobox protein HOX1A isoform X3
TrEMBLK3Z4970.0K3Z497_SETIT; Uncharacterized protein
STRINGSi021365m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-74Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain